PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G31990.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 556aa    MW: 60131.8 Da    PI: 4.8859
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G31990.2genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-164592148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT  Ed +lvd+vk++G g+W+++ +  g+ R++k+c++rw ++l
  OMERI01G31990.2 45 KGPWTSAEDAILVDYVKKHGEGNWNAVQKNTGLFRCGKSCRLRWANHL 92
                     79******************************************9986 PP

2Myb_DNA-binding50.93.5e-1698141146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eE+ l+++++ ++G++ W++ a++++ gRt++++k++w++
  OMERI01G31990.2  98 KGAFTAEEERLIIQLHSKMGNK-WARMAAHLP-GRTDNEIKNYWNT 141
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0016932.1E-2951556IPR016310Transcription factor, GAMYB
PROSITE profilePS5129416.6254092IPR017930Myb domain
SuperFamilySSF466897.49E-3142139IPR009057Homeodomain-like
SMARTSM007172.1E-144494IPR001005SANT/Myb domain
PfamPF002491.1E-144592IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-234699IPR009057Homeodomain-like
CDDcd001672.71E-114792No hitNo description
PROSITE profilePS5129425.02693147IPR017930Myb domain
SMARTSM007176.3E-1797145IPR001005SANT/Myb domain
PfamPF002493.8E-1598141IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-25100145IPR009057Homeodomain-like
CDDcd001672.22E-12100141No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009789Biological Processpositive regulation of abscisic acid-activated signaling pathway
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045926Biological Processnegative regulation of growth
GO:0048235Biological Processpollen sperm cell differentiation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 556 aa     Download sequence    Send to blast
MYRVKSESDC EMIHQEQMDS PVADDGSSGG SPHRGGGGGG PPLKKGPWTS AEDAILVDYV  60
KKHGEGNWNA VQKNTGLFRC GKSCRLRWAN HLRPNLKKGA FTAEEERLII QLHSKMGNKW  120
ARMAAHLPGR TDNEIKNYWN TRIKRCQRAG LPIYPTSVCN QSSNEDQQCS SDFDCGENLS  180
NDLLNANGLY LPDFTCDNFI ANSEALPYAP HLSAVSISNL LGQSFASKSC SFMDQVNQTG  240
MLKQSDGVLP GLSDTINGVL SSVDQFSNDS EKLKQAVGFD YLHEANSSSK IIAPFGGALN  300
GSHAFLNGNF SASRPTSGPL KMELPSLQDT ESDPNSWLKY TVAPALQPTE LVDPYLQSPA  360
ATPSVKSECA SPRNSGLLEE LIHEAQTLRS GKNQQTSVIS SSSSVGTPCN TTVLSPEFDM  420
CQEYWEEQHP GPFLNDCAPF SGNSFTESTP PVSAASPDIF QLSKVSPAQS TSMGSGEQVM  480
GPKYEPGDTS PHPENFRPDA LFSGNTADPS VFNNAIAMLL GNDLSIDCRP VLGDGIMFNS  540
SSWSNMPHAC EMSEFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-33391451106B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00490DAPTransfer from AT5G06100Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8308820.0CT830882.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA246D08, full insert sequence.
GenBankCT8308840.0CT830884.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCFA248K02, full insert sequence.
GenBankX983550.0X98355.1 O.sativa mRNA for transcription activator, GAMyb.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015622335.10.0PREDICTED: transcription factor GAMYB
RefseqXP_015622336.10.0PREDICTED: transcription factor GAMYB
SwissprotA2WW870.0GAM1_ORYSI; Transcription factor GAMYB
TrEMBLA0A0E0C9C60.0A0A0E0C9C6_9ORYZ; Uncharacterized protein
STRINGBGIOSGA004670-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39473664
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.35e-88myb domain protein 33